PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00044902001
Common NameGSBRNA2T00044902001, LOC106432304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 441aa    MW: 47301.6 Da    PI: 5.5792
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00044902001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-39124183261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  GSBRNA2T00044902001 124 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKNP 183
                          7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-32120181IPR003851Zinc finger, Dof-type
PfamPF027018.6E-32126182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.64128182IPR003851Zinc finger, Dof-type
PROSITE patternPS013610130166IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MSDPAIKLFG KTIPLPELLG GDLTEQQDQN PVRLSDSCTG DDEEMGDSGL AGGGGGDDGG  60
CGDSESQKEE KDTECGDESL CNESSKVSAA SSITEKTETT KVAKTDEETS QNGTCSQEGK  120
LKKPDKILPC PRCNSMETKF CYYNNYNVNQ PRHFCKKCQR YWTAGGTMRN VPVGAGRRKN  180
KNPASHFNRH VTITSAEAMQ KAAAARTADN GTSLLTFGSD SVLCESMASG LNLADKSMLK  240
KTEASAGLKI TVPLNPSKEQ AGTISPLPCF PGPPPPPPTW PYAWNGVSWT AVPFYPPPAY  300
WSYPGVSPGT WNSIAWMPQP TSPSAGSGPN SPTLGKHSRD ESIAEPGTVL EETESPLGRE  360
KSKSERCLWV PKTLRIDDPE EAAKSSIWET LGIKKDEKAD TFGAFRSPNK EKSSLSQGRR  420
PELQANPAAL SRSANFHESS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00044902001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529391e-148AK352939.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-18-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728598.10.0PREDICTED: cyclic dof factor 2-like isoform X1
SwissprotQ93ZL50.0CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A078GXM90.0A0A078GXM9_BRANA; BnaC04g31720D protein
STRINGBra025655.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137951825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.20.0cycling DOF factor 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]